PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 91aa    MW: 11109.7 Da    PI: 8.4302
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17295.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.67.5e-301591178
        NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknrat 78
               + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t
  PK17295.1 15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVT 91
               579***************************.89***************9888999*********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-311391IPR003441NAC domain
PROSITE profilePS5100530.7411591IPR003441NAC domain
PfamPF023654.1E-131782IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MDHERSEGDK LEEVMLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL  60
PKLASTGEKE WYFYCPRDRK YRNSTRPNRV T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-28791893NO APICAL MERISTEM PROTEIN
1ut4_B3e-28791893NO APICAL MERISTEM PROTEIN
1ut7_A3e-28791893NO APICAL MERISTEM PROTEIN
1ut7_B3e-28791893NO APICAL MERISTEM PROTEIN
3swm_A3e-287911196NAC domain-containing protein 19
3swm_B3e-287911196NAC domain-containing protein 19
3swm_C3e-287911196NAC domain-containing protein 19
3swm_D3e-287911196NAC domain-containing protein 19
3swp_A3e-287911196NAC domain-containing protein 19
3swp_B3e-287911196NAC domain-containing protein 19
3swp_C3e-287911196NAC domain-containing protein 19
3swp_D3e-287911196NAC domain-containing protein 19
4dul_A3e-28791893NAC domain-containing protein 19
4dul_B3e-28791893NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002522427.13e-56PREDICTED: protein FEZ
SwissprotQ9ZVH05e-50FEZ_ARATH; Protein FEZ
TrEMBLB9S8V83e-56B9S8V8_RICCO; NAC domain-containing protein, putative
STRINGVIT_01s0026g02360.t012e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.13e-51NAC family protein